HORDB

ID: hor005583
Uniprot ID: Q5U9D2
Protein name: Hepcidin
Gene name: HAMP
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
Family: Hepcidin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0006879 intracellular iron ion homeostasis; GO:0007165 signal transduction; GO:0034760 negative regulation of iron ion transmembrane transport; GO:0042742 defense response to bacterium
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: DTHFPICIFCCGCCKTPKCGLCCKT
Length: 25
Propeptide: MALSTRIQAACLLLLLLASVASVSVLPHQTGQLTDLRAQDTAGAEAGLQPTLQLRRLRRRDTHFPICIFCCGCCKTPKCGLCCKT
Signal peptide: MALSTRIQAACLLLLLLASVAS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. May also have antimicrobial activity
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005583_AF2.pdb

hor005583_ESM.pdb

Mass:	315366	Formula:	C114H182N30O31S8
Absent amino acids:	AEMNQRSVWY	Common amino acids:	C
pI:	7.97	Basic residues:	4
Polar residues:	13	Hydrophobic residues:	5
Hydrophobicity:	55.6	Boman Index:	-490
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	46.8
Instability Index:	714.4	Extinction Coefficient cystines:	500
Absorbance 280nm:	20.83